We are a branding & communications agency in Hyderabad and Vijayawada. we do Brand identity development,Marketing and advertising campaign development,print,websites,brochures,packaging,publications, digital marketing,product photography,corporate films and documentaries.

2.50 Rating by CuteStat

xplusone.in is 8 years 7 months old. It is a domain having in extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, xplusone.in is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 23,300
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 3 H2 Headings: Not Applicable
H3 Headings: 1 H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 3
Google Adsense: Not Applicable Google Analytics: UA-73918346-1

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 15 Dec 2019 09:51:50 GMT
Server: Apache
Last-Modified: Wed, 21 Sep 2016 12:37:48 GMT
Accept-Ranges: bytes
Content-Length: 10341
Content-Type: text/html

Domain Information

Domain Registrar: Acens Technologies, S.L.U.
Registration Date: Sep 17, 2015, 11:24 AM 8 years 7 months 1 week ago
Expiration Date: Sep 17, 2020, 11:24 AM 3 years 7 months 1 week ago
Domain Status:
clienttransferprohibited
clientrenewprohibited
clientdeleteprohibited
clientupdateprohibited

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
xplusone.in A 10800 IP: 103.24.200.143
xplusone.in NS 86400 Target: ns2.lazybulls.com
xplusone.in NS 86400 Target: ns1.lazybulls.com
xplusone.in SOA 10800 MNAME: ns1.lazybulls.com
RNAME: root.i-h1-cs-r04-i0117-141.webazilla.com
Serial: 2019061802
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
xplusone.in MX 14400 Priority: 10
Target: alt3.aspmx.l.google.com
xplusone.in MX 14400 Priority: 10
Target: alt4.aspmx.l.google.com
xplusone.in MX 14400 Priority: 1
Target: aspmx.l.google.com
xplusone.in MX 14400 Priority: 5
Target: alt1.aspmx.l.google.com
xplusone.in MX 14400 Priority: 5
Target: alt2.aspmx.l.google.com

Full WHOIS Lookup

Domain Name: xplusone.in
Registry Domain ID: D9846052-IN
Registrar WHOIS Server:
Registrar URL: www.godaddy.com
Updated Date: 2019-03-10T11:14:47Z
Creation Date: 2015-09-17T05:39:43Z
Registry Expiry Date: 2020-09-17T05:39:43Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: iteacher
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Andhra Pradesh
Registrant Postal Code:
Registrant Country: IN
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server: ns1.lazybulls.com
Name Server: ns2.lazybulls.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2019-12-15T09:51:56Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only ,and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator or a Registrar, or Neustar except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.